{{cs1 config|name-list-style=vanc}} {{Pfam box | Symbol = Cecropin | Name = Cecropin family | image = Cecropin.png | width = | caption = Model of ''Drosophila melanogaster'' Cecropin A | Pfam= PF00272 | InterPro= IPR000875 | SMART= | Prosite = PDOC00241 | SCOP = 1f0d | TCDB = 1.C.17 | OPM family= 151 | OPM protein= 1d9j | PDB= }}

'''Cecropins''' are antimicrobial peptides.<ref>{{MeshName|Cecropins}}</ref><ref name="pmid19176529">{{cite journal | vauthors = Lauwers A, Twyffels L, Soin R, Wauquier C, Kruys V, Gueydan C | title = Post-transcriptional Regulation of Genes Encoding Anti-microbial Peptides in Drosophila | journal = The Journal of Biological Chemistry | volume = 284 | issue = 13 | pages = 8973–83 | date = March 2009 | pmid = 19176529 | pmc = 2659254 | doi = 10.1074/jbc.M806778200 | doi-access = free }}</ref> They were first isolated from the hemolymph of ''Hyalophora cecropia'', whence the term cecropin was derived. Cecropins lyse bacterial cell membranes; they also inhibit proline uptake and cause leaky membranes.

Cecropins<ref name="PUB00000112">{{cite journal | vauthors = Boman HG, Hultmark D | title = Cell-free immunity in insects | journal = Annual Review of Microbiology | volume = 41 | pages = 103–26 | year = 1987 | pmid = 3318666 | doi = 10.1146/annurev.mi.41.100187.000535 }}</ref><ref name="PUB00000851">{{cite journal | vauthors = Boman HG | title = Antibacterial peptides: key components needed in immunity | journal = Cell | volume = 65 | issue = 2 | pages = 205–7 | date = April 1991 | pmid = 2015623 | doi = 10.1016/0092-8674(91)90154-Q | s2cid = 42206617 }}</ref><ref name="PUB00001402">{{cite journal | vauthors = Boman HG, Faye I, Gudmundsson GH, Lee JY, Lidholm DA | title = Cell-free immunity in Cecropia. A model system for antibacterial proteins | journal = European Journal of Biochemistry | volume = 201 | issue = 1 | pages = 23–31 | date = October 1991 | pmid = 1915368 | doi = 10.1111/j.1432-1033.1991.tb16252.x | doi-access = free }}</ref> constitute a main part of the innate immune system of insects. Cecropins are small proteins anywhere from 31 to 37 amino acids long and are active against both gram-positive and gram-negative bacteria. Cecropins isolated from insects other than ''Hyalophora cecropia'' (Cecropia moth) have been given various names, such as bactericidin, {{chem name|lepidopterin}}, and sarcotoxin. All of these peptides are structurally related.

==Members== Members include:

;Cecropin A: Peptide Sequence (KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK). Secondary structure includes two α helices.<ref name=Hoskin2008/>{{rp|4.2}} At low peptide to lipid ratios ion channels are formed, at high peptide to lipid ratios pores are formed.<ref>{{cite thesis | first = Loraine Susan | last = Silvestro | title = Function and structure of cecropin A | date = January 2000 | degree = Ph.D. | publisher = University of Pennsylvania | url = http://repository.upenn.edu/dissertations/AAI9965567 }}</ref>

;Cecropin B: Peptide Sequence (KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL). Secondary structure includes two α helices.<ref name=Hoskin2008/>{{rp|4.2}}

;CECD: from Aedes aegypti (Yellowfever mosquito).<ref name=ODB-cecropin>{{Cite web|url=https://opm.phar.umich.edu/families.php?family=208|title=OPM|website=opm.phar.umich.edu}}</ref>

;Papiliocin: from Papilio xuthus (a butterfly) <ref name=ODB-cecropin/>

;Cecropin P1: Peptide Sequence (SWLSKTAKKLENSAKKRISEGIAIAIQGGPR). An antibacterial peptide from ''Ascaris suum'', a parasitic nematode that resides in the pig intestine, also belongs to this family.{{citation needed|date=March 2023}}

==Derivatives== A derivative of Cecropin B is an anticancer polypeptide(L). Structure consists of mainly alpha helixes, determined by solution NMR. Protein molecular weight = 4203.4g/mol.<ref name="pmid19428759">{{PDB|2IGR}}; {{cite journal | vauthors = Wu JM, Jan PS, Yu HC, Haung HY, Fang HJ, Chang YI, Cheng JW, Chen HM | display-authors = 6 | title = Structure and function of a custom anticancer peptide, CB1a | journal = Peptides | volume = 30 | issue = 5 | pages = 839–48 | date = May 2009 | pmid = 19428759 | doi = 10.1016/j.peptides.2009.02.004 | s2cid = 32115657 }}</ref>

Some of the cecropins (e.g. cecropin A, and cecropin B) have anticancer properties and are called anticancer peptides (ACPs).<ref name=Hoskin2008/>{{rp|3}} Hybrid ACPs based on Cecropin A have been studied for anticancer properties.<ref name=Hoskin2008>{{cite journal | vauthors = Hoskin DW, Ramamoorthy A | title = Studies on anticancer activities of antimicrobial peptides | journal = Biochimica et Biophysica Acta (BBA) - Biomembranes | volume = 1778 | issue = 2 | pages = 357–75 | date = February 2008 | pmid = 18078805 | pmc = 2238813 | doi = 10.1016/j.bbamem.2007.11.008 }}</ref>{{rp|7.1}}

==Anticancer properties== Anticancer activities of cecropin B, cecropin P1, and Shiva-1 were first demonstrated with in vitro studies of mammalian leukemia and lymphoma cell lines, where cells were sensitive to peptide concentrations on the order of 10<sup>−6</sup> M.<ref name=ACP>{{cite journal | vauthors = Moore AJ, Devine DA, Bibby MC | title = Preliminary experimental anticancer activity of cecropins | journal = Peptide Research | volume = 7 | issue = 5 | pages = 265–9 | date = 1994 | pmid = 7849420 }}</ref> Two multidrug-resistant breast and ovarian cancer cell lines also showed sensitivity to the peptides.<ref name=ACP/> Further, peptide anticancer activity is reported as being complete within one hour of treatment.<ref name=ACP/> In vivo studies of murine ascitic colon adenocarcinoma cells showed a similar trend, where mice treated with cecropin B exhibited increased survival time compared to untreated mice.<ref name=ACP/> Structural studies of cecropin B and its derivative cecropin B3 showed that anticancer activity arises from the ability of the antimicrobial peptides to form pores in stomach carcinoma cell membranes.<ref name=Hoskin2008/><ref name=pores>{{cite journal | vauthors = Ye JS, Zheng XJ, Leung KW, Chen HM, Sheu FS | title = Induction of transient ion channel-like pores in a cancer cell by antibiotic peptide | journal = Journal of Biochemistry | volume = 136 | issue = 2 | pages = 255–9 | date = August 2004 | pmid = 15496597 | doi = 10.1093/jb/mvh114 | doi-access = free }}</ref> Measuring electrical currents on cell surfaces showed that cecropin B, but not cecropin B3, induces outward currents indicative of pore formation.<ref name=pores/> Further, cecropin B3 lacks an amphipathic group present in cecropin B, suggesting that this amphipathic group is necessary for cecropin B to insert into cell membranes and form pores.<ref name=pores/> Cecropin B has strong activity on bacteria as well as cancer cells, while B3 has little effect on either.<ref name=pores/> Notably, another derivative, cecropin B1, has two amphipathic regions and exhibits potent activity against human leukemia cell lines at concentrations that do not affect normal fibroblasts or red blood cells.<ref name=Hoskin2008/>

Different cecropins act on different types of human cancer cells and show activity at concentrations that are not harmful to normal cells. For example, a recent study of Cecropins A and B demonstrated strongly cytotoxic activity against four bladder cancer cell lines, while benign murine and human fibroblasts were not susceptible to Cecropin A or B.<ref>{{cite journal | vauthors = Suttmann H, Retz M, Paulsen F, Harder J, Zwergel U, Kamradt J, Wullich B, Unteregger G, Stöckle M, Lehmann J | display-authors = 6 | title = Antimicrobial peptides of the Cecropin-family show potent antitumor activity against bladder cancer cells | journal = BMC Urology | volume = 8 | pages = 5 | date = March 2008 | pmid = 18315881 | pmc = 2276511 | doi = 10.1186/1471-2490-8-5 | doi-access = free }}</ref> Cecropins from many insect species have been shown to be active against a diverse range of human cancer cell lines. For example, Mdcec, a cecropin originating from the common housefly, has been shown to have an antiproliferative effect on human hepatocellular carcinoma cell line BEL-7402 without affecting normal liver cells.<ref name=Mdcec>{{cite journal | vauthors = Jin X, Mei H, Li X, Ma Y, Zeng AH, Wang Y, Lu X, Chu F, Wu Q, Zhu J | display-authors = 6 | title = Apoptosis-inducing activity of the antimicrobial peptide cecropin of Musca domestica in human hepatocellular carcinoma cell line BEL-7402 and the possible mechanism | journal = Acta Biochimica et Biophysica Sinica | volume = 42 | issue = 4 | pages = 259–65 | date = April 2010 | pmid = 20383464 | doi = 10.1093/abbs/gmq021 | doi-access = }}</ref> Flow cytometry and RT-PCR experiments revealed that treatment with Mdcec increased expression of pro-apoptotic genes such as caspase-3, leading to cancer cell death.<ref name=Mdcec/> These same genes did not show significant expression changes in healthy cells upon treatment with Mdcec.<ref name=Mdcec/> This suggests a degree of specificity which has promise for development of novel cancer therapies.

Further supporting therapeutic efficacy, a study of cecropin A affirmed that cecropin A selectively lyses leukemia cells while exerting little effect on normal lymphocytes.<ref name=synergy>{{cite journal | vauthors = Hui L, Leung K, Chen HM | title = The combined effects of antibacterial peptide cecropin A and anti-cancer agents on leukemia cells | journal = Anticancer Research | volume = 22 | issue = 5 | pages = 2811–6 | date = 2002 | pmid = 12530001 }}</ref> In the same study, chemotherapy drugs cytarabine and 5-fluorouracil synergize with cecropin A in vitro to enhance cytotoxic effects on leukemia cells.<ref name=synergy/> This indicates potential for therapeutic application of antimicrobial peptides in cancer, where treatment with cecropins could lower the required dosage of chemotherapy drugs, reducing undesirable side effects. Major challenges to the use of cecropins as cancer therapeutics are delivery of the peptides to tumor cells.<ref name=Hoskin2008/><ref name=gene>{{cite journal | vauthors = Winder D, Günzburg WH, Erfle V, Salmons B | title = Expression of antimicrobial peptides has an antitumour effect in human cells | journal = Biochemical and Biophysical Research Communications | volume = 242 | issue = 3 | pages = 608–12 | date = January 1998 | pmid = 9464264 | doi = 10.1006/bbrc.1997.8014 }}</ref> Repeated administration of peptides is necessary to maintain systemic levels of cecropins at sufficient concentrations for anti-cancer activity.<ref name=Hoskin2008/><ref name=gene/> This need for repeated administration complicates potential treatment plans. One proposed alternative suggests use of gene therapy to introduce cecropin genes into cancer cells.<ref name=Hoskin2008/><ref name=gene/> A study in which cecropin genes were expressed in a human bladder carcinoma cell line showed that tumor cells bearing cecropin genes have reduced tumorigenicity, up to complete loss of tumorigenicity in some cell clones.<ref name=gene/>

More recent studies have identified new cecropins, which may be prove useful in development of cancer therapeutics. For example, genome and transcriptome analyses of the spruce budworm ''Choristoneura fumiferana'' resulted in identification of novel cecropins which differ from previously characterized cecropins in that they are negatively charged, rather than positively charged.<ref name=anion>{{cite journal | vauthors = Maaroufi H, Potvin M, Cusson M, Levesque RC |title=Novel antimicrobial anionic cecropins from the spruce budworm feature a poly-L-aspartic acid C-terminus |journal=Proteins | volume=89 | issue=9 | date=2021-05-11 | issn=0887-3585 | doi=10.1002/prot.26142 | pages=1205–1215|pmid=33973678 |s2cid=234359784 }}</ref> A BH3-like motif (amino acid sequence G-[KQR]-[HKQNR]-[IV]-[KQR]) is present in both anionic and cationic cecropins, and analysis suggests that this motif may interact with Bcl-2, a protein implicated in apoptosis.<ref name=anion/> Further study of cecropin structure and anticancer properties may inform design of novel cancer therapeutics.

==Antibiofilm properties== Cecropin A can destroy planktonic and sessile biofilm-forming uropathogenic ''E. coli'' (UPEC) cells, either alone or when combined with the antibiotic nalidixic acid, synergistically clearing infection in vivo (in the insect host ''Galleria mellonella'') without off-target cytotoxicity. The multi-target mechanism of action involves outer membrane permeabilization followed by biofilm disruption triggered by the inhibition of efflux pump activity and interactions with extracellular and intracellular nucleic acids.<ref>{{cite journal | vauthors = Kalsy M, Tonk M, Hardt M, Dobrindt U, Zdybicka-Barabas A, Cytrynska M, Vilcinskas A, Mukherjee K | title = The insect antimicrobial peptide cecropin A disrupts uropathogenic Escherichia coli biofilms | journal = npj Biofilms and Microbiomes | volume = 6 | issue = 1 | pages = 6 | date = 2020 | pmid = 32051417 | doi = 10.1038/s41522-020-0116-3 | pmc = 7016129 | doi-access = free }}></ref>

== References == {{reflist}}

== Further reading == * Hoskin 2008 (above) section 4.2

== External links == * [http://opm.phar.umich.edu/families.php?family=208 Cecropins. OPM]

{{Membrane proteins}} {{Pore-forming toxins}}

Category:Antimicrobial peptides Category:Insect immunity