{{Short description|Nuclear genetic code in some ciliates}}

The '''peritrich nuclear code''' (translation table 30) is a genetic code used by the nuclear genome of the peritrich ciliates ''Vorticella'' and ''Opisthonecta''.<ref>{{Cite journal|last1=Sánchez-Silva|first1=Rocı́o|last2=Villalobo|first2=Eduardo|last3=Morin|first3=Loı̈c|last4=Torres|first4=Antonio|year=2003|title=A New Noncanonical Nuclear Genetic Code|journal=Current Biology|volume=13|issue=5|pages=442–447|doi=10.1016/s0960-9822(03)00126-x|pmid=12620196|s2cid=17484731|doi-access=free}}</ref>

==The code (30)== :<code>&nbsp;&nbsp;&nbsp;AAs = FFLLSSSSYYEECC*WLLLAPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG</code> :<code>Starts = --------------*--------------------M----------------------------</code> :<code>&nbsp;Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG</code> :<code>&nbsp;Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG</code> :<code>&nbsp;Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG</code>

Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).

Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), and Valine (Val, V).

==Differences from the standard code== {|class="wikitable" style="border: none; text-align: center;" |+ |- ! DNA codons !! RNA codons !! This code (30) !! style="border: none; width: 1px;" | !! Standard code (1) |- | {{mono|TAA}} || {{mono|UAA}} || style="background-color:#f8b7d3;" | {{mono|Glu (E)}} || style="border: none; width: 1px;" | || style="background-color:#B0B0B0;" | {{mono|Ter (*)}} |- | {{mono|TAG}} || {{mono|UAG}} || style="background-color:#f8b7d3;" | {{mono|Glu (E)}} || style="border: none; width: 1px;" | || style="background-color:#B0B0B0;" | {{mono|Ter (*)}} |}

==See also== * List of all genetic codes: translation tables 1 to 16, and 21 to 31. * The genetic codes database.

==References== {{NLM content}}<ref name="NCBI">{{cite web | first1 = Andrzej | last1 = Elzanowski | first2 = Jim | last2 = Ostell | first3 = Detlef | last3 = Leipe | first4 = Vladimir | last4 = Soussov | name-list-style = vanc |url=https://www.ncbi.nlm.nih.gov/Taxonomy/taxonomyhome.html/index.cgi?chapter=tgencodes#thetop |title= The Genetic Codes|access-date=18 November 2016 | work = Taxonomy browser | publisher = National Center for Biotechnology Information (NCBI), US National Library of Medicine }}</ref>

{{reflist}}

{{Authority control}} {{Use dmy dates|date=July 2025}}

Category:Molecular genetics Category:Gene expression Category:Protein biosynthesis