{{Short description|Alternative genetic code in some spirotrich ciliates}}
The '''euplotid nuclear code''' (translation table '''10''') is the genetic code used by Euplotidae. The euplotid code is a socalled "symmetrical code", which results from the symmetrical distribution of the codons. This symmetry allows for arythmic exploration of the codon distribution. In 2013, shCherbak and Makukov, reported that "the patterns are shown to match the criteria of an intelligent signal."<ref>{{cite journal |last1=shCherbak |first1=Vladimir I. |last2=Makukov |first2=Maxim A. |title=The 'Wow! signal' of the terrestrial genetic code |journal=Icarus |date=May 2013 |volume=224 |issue=1 |pages=228–242 |doi=10.1016/j.icarus.2013.02.017 |bibcode=2013Icar..224..228S |arxiv=1303.6739 |s2cid=16507813 }}</ref>
==The code==
:<code> AAs = FFLLSSSSYY**CCCWLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG</code> :<code>Starts = -----------------------------------M----------------------------</code> :<code> Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG</code> :<code> Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG</code> :<code> Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG</code>
Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).
Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V)
==Differences from the standard code==
{|class="wikitable" style="border: none; text-align: center;" |+ |- ! DNA codons !! RNA codons !! This code (10) !! style="border: none; width: 1px;" | !! Standard code (1) |- | <code>TGA</code> || <code>UGA</code> || style="background-color:#b3dec0;" | <code>Cys</code> <code>(C)</code> || style="border: none; width: 1px;" | || style="background-color:#B0B0B0;" | <code>STOP = Ter</code> <code>(*)</code> |}
==Systematic range== * Ciliata: Euplotidae<ref name="Hoffman" />
==See also== * List of genetic codes
==References== {{NLM content}}<ref name="NCBI">{{cite web | first1 = Andrzej | last1 = Elzanowski | first2 = Jim | last2 = Ostell | first3 = Detlef | last3 = Leipe | first4 = Vladimir | last4 = Soussov | name-list-style = vanc |url=https://www.ncbi.nlm.nih.gov/Taxonomy/taxonomyhome.html/index.cgi?chapter=tgencodes#thetop |title= The Genetic Codes|access-date=19 March 2016 | work = Taxonomy browser | publisher = National Center for Biotechnology Information (NCBI), U.S. National Library of Medicine }}</ref> {{Reflist| refs= <ref name="Hoffman">{{Cite journal|journal=Nucleic Acids Res|date=25 April 1995|volume=23|issue=8|pages=1279–83|title=Macronuclear gene-sized molecules of hypotrichs|author1=D. C. Hoffman |author2=R. C. Anderson |author3=M. L. DuBois |author4=D. M. Prescott |doi=10.1093/nar/23.8.1279 |pmid=7753617 |pmc=306850}}</ref> }}
{{Use dmy dates|date=October 2019}}
{{DEFAULTSORT:Euplotid nuclear code, The}} Category:Molecular genetics Category:Gene expression Category:Protein biosynthesis