{{Infobox protein family | Symbol = Toxin_2 | Name = Scorpion short toxin | image = 1agt.png | width = | caption = Agitoxin-2. Disulphide bonds are highlighted. PDB {{PDBe|1agt}} <ref name="struct">{{cite journal | vauthors = Krezel AM, Kasibhatla C, Hidalgo P, MacKinnon R, Wagner G | title = Solution structure of the potassium channel inhibitor agitoxin 2: caliper for probing channel geometry | journal = Protein Science | volume = 4 | issue = 8 | pages = 1478–89 | date = August 1995 | pmid = 8520473 | pmc = 2143198 | doi = 10.1002/pro.5560040805 }}</ref> | Pfam = PF00451 | Pfam_clan = CL0054 | InterPro = IPR001947 | SMART = | PROSITE = PDOC00875 | MEROPS = | SCOP = | OPM family = 58 | OPM protein = 3odv | CAZy = | CDD = }}

'''Agitoxin''' is a toxin found in the venom of the scorpion ''Leiurus quinquestriatus hebraeus'' (yellow scorpion). Other toxins found in this species include charybdotoxin (CTX). CTX is a close homologue of Agitoxin.<ref>{{cite journal | vauthors = Bontems F, Roumestand C, Gilquin B, Ménez A, Toma F | title = Refined structure of charybdotoxin: common motifs in scorpion toxins and insect defensins | journal = Science | volume = 254 | issue = 5037 | pages = 1521–3 | date = December 1991 | pmid = 1720574 | doi = 10.1126/science.1720574 | bibcode = 1991Sci...254.1521B }}</ref>

== Structure ==

Agitoxin can be purified using HPLC techniques.

'''Primary structure:'''

Three types of agitoxin can be distinguished, each identified as comprising 38 amino acids. They are highly homologous, differing only in the identity of the residues at positions 7, 15, 29 and 31.

Alignment of Agitoxins. Disulphide bonds are indicated beneath the alignment.

*'''Agitoxin-1''' Gly-Val-Pro-Ile-Asn-Val-Lys-Cys-Thr-Gly-Ser-Pro-Gln-Cys-Leu-Lys-Pro-Cys-Lys-Asp-Ala-Gly-Met-Arg-Phe-Gly-Lys-Cys-Ile-Asn-Gly-Lys-Cys-His-Cys-Thr-Pro-Lys (GVPINVKCTGSPQCLKPCKDAGMRFGKCINGKCHCTPK, molecular weight = 4014.87 Da, molecular formula = C<sub>169</sub>H<sub>278</sub>N<sub>52</sub>O<sub>47</sub>S<sub>7</sub>) *'''Agitoxin-2''' Gly-Val-Pro-Ile-Asn-Val-Ser-Cys-Thr-Gly-Ser-Pro-Gln-Cys-Ile-Lys-Pro-Cys-Lys-Asp-Ala-Gly-Met-Arg-Phe-Gly-Lys-Cys-Met-Asn-Arg-Lys-Cys-His-Cys-Thr-Pro-Lys (GVPINVSCTGSPQCIKPCKDAGMRFGKCMNRKCHCTPK, molecular weight = 4090.95 Da, molecular formula = C<sub>169</sub>H<sub>278</sub>N<sub>54</sub>O<sub>48</sub>S<sub>8</sub>) *'''Agitoxin-3''' Gly-Val-Pro-Ile-Asn-Val-Pro-Cys-Thr-Gly-Ser-Pro-Gln-Cys-Ile-Lys-Pro-Cys-Lys-Asp-Ala-Gly-Met-Arg-Phe-Gly-Lys-Cys-Met-Asn-Arg-Lys-Cys-His-Cys-Thr-Pro-Lys (GVPINVPCTGSPQCIKPCKDAGMRFGKCMNRKCHCTPK, molecular weight = 4100.98 Da, molecular formula = C<sub>171</sub>H<sub>280</sub>N<sub>54</sub>O<sub>47</sub>S<sub>8</sub>, CAS Number 155646-23-4)

'''Secondary and tertiary structure:'''

Agitoxin consists of a triple-stranded antiparallel beta-sheet in which the C-terminal strand sits in the centre of the sheet, and a single alpha-helix covering one face of the beta-sheet (see image on the right). The cysteine side chains connect the beta-sheet and the helix via disulphide bonds to form the core of the molecule.

The fold of agitoxin is homologous to the previously determined folds of scorpion venom toxins, classified as 'Scorpion short toxins' by Pfam. This fold, and the location of the disulphide bonds, are a shared element between toxins stemming from arthropods. The structure of agitoxin-2, has been determined by NMR.<ref name="struct"/>

== Function == Agitoxin binds to the Shaker ''K''<sup>+</sup> channel in ''Drosophila'' as well as to its mammalian homologue. It blocks this channel by binding with high affinity (''K''<sub>d</sub>&nbsp;< 1&nbsp;nmol/L) to its external vestibule.

This high affinity to the 'Shaker K' channel is dependent on the residues of Arg <sup>24</sup>, Lys <sup>27</sup>, and Arg <sup>31</sup>.<ref name="struct"/> The ability of the agitoxin to block the 'Shaker K' channel suggests a docking mechanism whereby the toxin sits on the channel and then prevents its opening through flexible movements of the side chains thereby allowing for various protein-protein complexes to be enacted.<ref name="ReferenceA">{{cite journal | vauthors = Eriksson MA, Roux B | title = Modeling the structure of agitoxin in complex with the Shaker K+ channel: a computational approach based on experimental distance restraints extracted from thermodynamic mutant cycles | journal = Biophysical Journal | volume = 83 | issue = 5 | pages = 2595–609 | date = November 2002 | pmid = 12414693 | pmc = 1302345 | doi = 10.1016/S0006-3495(02)75270-3 | bibcode = 2002BpJ....83.2595E }}</ref> AgTx2 has been found to undergo conformational changes when bound to the 'Shaker K' channel which suggests the induced fit model may be present in toxin-channel interaction. This mode of interaction goes along with and explains the flexible side chains.<ref>{{cite journal | vauthors = Lin YW, Wang KJ, Lei HY, Lin YS, Yeh TM, Liu HS, Liu CC, Chen SH | title = Virus replication and cytokine production in dengue virus-infected human B lymphocytes | journal = Journal of Virology | volume = 76 | issue = 23 | pages = 12242–9 | date = December 2002 | pmid = 12414963 | pmc = 136880 | doi = 10.1128/JVI.76.23.12242-12249.2002 }}</ref> The amino acid make up of the toxin determines the way each interacts with Shaker K channels.<ref name="struct"/>

In Agitoxin, for example, the arginine interacts electrostatically with the aspartate of the 'Shaker K' channel.<ref name="struct"/> The final blocking of the pore in the Shaker K + channel occurs via the side chain of Lys <sup>27</sup>.<ref name="ReferenceA"/> Lys <sup> 27</sup> interacts with the Shaker K by plugging the selectivity filter and hydrogen bonding with carbonyls of Tyr <sup>395</sup> of each potassium channel subunit.<ref name="ReferenceB">{{cite journal | vauthors = Gao YD, Garcia ML | title = Interaction of agitoxin2, charybdotoxin, and iberiotoxin with potassium channels: selectivity between voltage-gated and Maxi-K channels | journal = Proteins | volume = 52 | issue = 2 | pages = 146–54 | date = August 2003 | pmid = 12833539 | doi = 10.1002/prot.10341 | s2cid = 7136604 }}</ref> Important stabilizing hydrogen bonding between various residues on the AgTx2 and the subunits of the channel hold the toxin-channel complex together. Mutations in Arg24Ala, Lys27Met, and Asn30Ala increased the dissociation, or break-down, of the complex, suggesting they all play important roles in holding the toxin on the channel.<ref name="ReferenceB"/>

== References == {{reflist|32em}}

== Further reading == {{refbegin}} *{{cite journal |last1=Oiki |first1=S. |last2=Uchihashi |first2=T. |last3=Sumikama |first3=T. |last4=Sumino |first4=A. |title=High-speed AFM reveals accelerated binding of agitoxin-2 to a K+ channel by induced fit |journal=Science Advances |date=1 July 2019 |volume=5 |issue=7 |article-number=eaax0495 |doi=10.1126/sciadv.aax0495 |pmid=31281899 |pmc=6609221 |bibcode=2019SciA....5..495S |language=en |issn=2375-2548|doi-access=free }} * {{cite journal | vauthors = Garcia ML, Garcia-Calvo M, Hidalgo P, Lee A, MacKinnon R | title = Purification and characterization of three inhibitors of voltage-dependent K+ channels from Leiurus quinquestriatus var. hebraeus venom | journal = Biochemistry | volume = 33 | issue = 22 | pages = 6834–9 | date = June 1994 | pmid = 8204618 | doi = 10.1021/bi00188a012 }} * {{cite journal | vauthors = Gao YD, Garcia ML | title = Interaction of agitoxin2, charybdotoxin, and iberiotoxin with potassium channels: selectivity between voltage-gated and Maxi-K channels | journal = Proteins | volume = 52 | issue = 2 | pages = 146–54 | date = August 2003 | pmid = 12833539 | doi = 10.1002/prot.10341 | s2cid = 7136604 }} {{refend}}

{{Toxins}}

Category:Neurotoxins Category:Ion channel toxins Category:Scorpion toxins